r 2007 b Search Results


fitc avidin  (Vector Laboratories)
93
Vector Laboratories fitc avidin
Fitc Avidin, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2007+b/10__1128_slash_jvi__75__16__7683___7691__2001-108-5-39?v=Vector+Laboratories
Average 93 stars, based on 1 article reviews
fitc avidin - by Bioz Stars, 2026-07
93/100 stars
  Buy from Supplier
transfluthrin  (Rosenheimer Technische Arbeitsmittel)
90
Rosenheimer Technische Arbeitsmittel transfluthrin
Transfluthrin, supplied by Rosenheimer Technische Arbeitsmittel, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2007+b/pm32957265-246-13-14?v=Rosenheimer+Technische+Arbeitsmittel
Average 90 stars, based on 1 article reviews
transfluthrin - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier
beta i tubulin monoclonal antibody  (Elabscience)
N/A
There are five tubulins in human cells alpha beta gamma delta and epsilon Tubulins are conserved across species They form heterodimers which multimerize to form a microtubule filament An alpha and beta tubulin heterodimer is
   Buy from Supplier
rps3 protein  (Biosynth Carbosynth)
N/A
Recombinant human RPS3 protein (His tag)
   Buy from Supplier
map2k2 antibody  (Biosynth Carbosynth)
N/A
MAP2K2 antibody was raised using the C terminal of MAP2K2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV. Rabbit polyclonal MAP2K2 antibody raised against the C terminal of MAP2K2.
   Buy from Supplier
igg2a kappa antibody (rm107) [biotin]  (Novus Biologicals)
N/A
The IgG2a Kappa Antibody (RM107) [Biotin] from Novus is a IgG2a Kappa antibody to IgG2a Kappa. This antibody reacts with Mouse. The IgG2a Kappa antibody has been validated for the following applications: Western Blot, ELISA,
   Buy from Supplier
chlamydia pneumoniae omp recombinant antigen  (Biosynth Carbosynth)
N/A
Chlamydia pneumoniae OMP recombinant protein
   Buy from Supplier
donkey anti-rabbit igg h&l secondary antibody-biotin  (TargetMol)
N/A
   Buy from Supplier
enos antibody  (Biosynth Carbosynth)
N/A
Rabbit polyclonal eNOS antibody
   Buy from Supplier
samsn1 blocking peptide  (Biosynth Carbosynth)
N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of SAMSN1 antibody, catalog no. 70R-1961
   Buy from Supplier
beta-2 adrenergic r/adrb2 antibody (13d6) [biotin]  (Novus Biologicals)
N/A
The beta-2 Adrenergic R/ADRB2 Antibody (13D6) [Biotin] from Novus is a beta-2 Adrenergic R/ADRB2 antibody to beta-2 Adrenergic R/ADRB2. This antibody reacts with Human. The beta-2 Adrenergic R/ADRB2 antibody has been validated for the following
   Buy from Supplier
il8 antibody  (Biosynth Carbosynth)
N/A
Rabbit polyclonal IL8 antibody (FITC)
   Buy from Supplier

Image Search Results